PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf02602g01005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 62aa    MW: 7086.26 Da    PI: 11.2522
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf02602g01005.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.42.9e-311059251
                              ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                    SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                              rien + rqvtfskRrng+lKKA+ELSvLCdaev++iifs++gklye+ss
  Peinf101Scf02602g01005.1 10 RIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSTRGKLYEFSS 59
                              8***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.9E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.721161IPR002100Transcription factor, MADS-box
CDDcd002654.46E-36361No hitNo description
SuperFamilySSF554551.83E-29361IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.5E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-313859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 62 aa     Download sequence    Send to blast
MVRGKTQMRR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVSLIIFST RGKLYEFSSS  60
SL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A9e-19362261Myocyte-specific enhancer factor 2A
3mu6_B9e-19362261Myocyte-specific enhancer factor 2A
3mu6_C9e-19362261Myocyte-specific enhancer factor 2A
3mu6_D9e-19362261Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3705114e-97AY370511.1 Petunia x hybrida MADS-box protein FBP28 gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008438118.18e-36PREDICTED: MADS-box protein SOC1-like isoform X1
RefseqXP_008438119.16e-36PREDICTED: MADS-box protein SOC1-like isoform X2
RefseqXP_008438120.16e-36PREDICTED: MADS-box protein SOC1-like isoform X3
SwissprotO646459e-36SOC1_ARATH; MADS-box protein SOC1
SwissprotQ388381e-35AGL14_ARATH; Agamous-like MADS-box protein AGL14
TrEMBLQ6UGS41e-36Q6UGS4_PETHY; MADS-box protein FBP28 (Fragment)
TrEMBLQ9ATE34e-36Q9ATE3_PETHY; MADS-box transcription factor FBP28
STRINGGLYMA18G45780.19e-35(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.15e-37AGAMOUS-like 20